Loading...
Statistics
Advertisement

Faith Bible | Cedar Rapids, IA
www.faithb.org/

Faithb.org

Advertisement
Conversion Technology Metas Server
Faithb.org is hosted in United States / Pompano Beach . Faithb.org doesn't use HTTPS protocol. Number of used technologies: 9. First technologies: CSS, Font Awesome, Html, Number of used javascripts: 12. First javascripts: Jwplayer.js, Jquery.js, Jquery-migrate.min.js, Number of used analytics tools: 0. Number of used plugins, modules: 2. Its server type is: Apache. Its CMS is: Wordpress.

Technologies in use by Faithb.org

Technology

Number of occurences: 9
  • CSS
  • Font Awesome
  • Html
  • Javascript
  • jQuery
  • JW Player
  • Php
  • SuperFish
  • SVG

Advertisement

Javascripts

Number of occurences: 12
  • jwplayer.js
  • jquery.js
  • jquery-migrate.min.js
  • modernizr-2.5.3.min.js
  • jquery.dropdown.js
  • superfish.js
  • jquery.prettyPhoto.js
  • swipe.js
  • script.js
  • comment-reply.min.js
  • sb-instagram.min.js
  • wp-embed.min.js

Content Management System

Number of occurences: 1
  • Wordpress

Server Type

  • Apache

Powered by

  • PHP/5.6.22

CDN

Number of occurences: 2
  • BootstrapCDN
  • Maxcdn

Used plugins, modules

Number of plugins and modules: 2
  • instagram feed
  • portfolio slideshow

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Faithb.org

Missing HTTPS protocol.

    Meta - Faithb.org

    Number of occurences: 3
    • Name:
      Content:
    • Name: viewport
      Content: width=device-width
    • Name: author
      Content: http://www.faithb.org

    Server / Hosting

    • IP: 198.23.48.82
    • Latitude: 26.24
    • Longitude: -80.27
    • Country: United States
    • City: Pompano Beach

    Rname

    • dns1.supremedns.com
    • dns2.supremedns.com
    • mx2.supremebox.com
    • mx1.supremebox.com

    Target

    • root.us.cloudlogin.co

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Date: Fri, 17 Jun 2016 13:33:00 GMT Server: Apache X-Powered-By: PHP/5.6.22 Location: http://www.faithb.org/ Vary: User-Agent Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_xt27 X-Cache-Lookup: MISS from s_xt27:80 Via: 1.1 s_xt27 (squid/3.5.6) Connection: keep-alive HTTP/1.1 200 OK Date: Fri, 17 Jun 2016 13:33:01 GMT Server: Apache X-Powered-By: PHP/5.6.22 Link: ; rel="https://api.w.org/", ; rel=shortlink Vary: User-Agent Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_xt27 X-Cache-Lookup: MISS from s_xt27:80 Via: 1.1 s_xt27 (squid/3.5.6) Connection: keep-alive

    DNS

    host: faithb.org
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 198.23.48.82
    host: faithb.org
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns1.supremedns.com
    host: faithb.org
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns2.supremedns.com
    host: faithb.org
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: dns1.supremedns.com
    5. rname: root.us.cloudlogin.co
    6. serial: 1426524204
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 86400
    host: faithb.org
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx2.supremebox.com
    host: faithb.org
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx1.supremebox.com

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.aithb.org, www.fqaithb.org, www.qaithb.org, www.faithb.org, www.aithb.org, www.faaithb.org, www.aaithb.org, www.fyaithb.org, www.yaithb.org, www.ftaithb.org, www.taithb.org, www.fgaithb.org, www.gaithb.org, www.fbaithb.org, www.baithb.org, www.fwaithb.org, www.waithb.org, www.fsaithb.org, www.saithb.org, www.fdaithb.org, www.daithb.org, www.fraithb.org, www.raithb.org, www.f3aithb.org, www.3aithb.org, www.f4aithb.org, www.4aithb.org, www.fithb.org, www.faoithb.org, www.foithb.org, www.fapithb.org, www.fpithb.org, www.fa9ithb.org, www.f9ithb.org, www.faithb.org, www.fithb.org, www.faiithb.org, www.fiithb.org, www.fauithb.org, www.fuithb.org, www.fathb.org, www.fairthb.org, www.farthb.org, www.faifthb.org, www.fafthb.org, www.faivthb.org, www.favthb.org, www.faikthb.org, www.fakthb.org, www.fai,thb.org, www.fa,thb.org, www.faibthb.org, www.fabthb.org, www.faigthb.org, www.fagthb.org, www.faitthb.org, www.fatthb.org, www.faiythb.org, www.faythb.org, www.faiuthb.org, www.fauthb.org, www.faijthb.org, www.fajthb.org, www.faimthb.org, www.famthb.org, www.fainthb.org, www.fanthb.org, www.faihb.org, www.faitqhb.org, www.faiqhb.org, www.faitahb.org, www.faiahb.org, www.fait hb.org, www.fai hb.org, www.faitwhb.org, www.faiwhb.org, www.faitehb.org, www.faiehb.org, www.faitzhb.org, www.faizhb.org, www.faitxhb.org, www.faixhb.org, www.faitchb.org, www.faichb.org, www.faitb.org, www.faitheb.org, www.faiteb.org, www.faithdb.org, www.faitdb.org, www.faithcb.org, www.faitcb.org, www.faithub.org, www.faitub.org, www.faithjb.org, www.faitjb.org, www.faithb.org, www.faitb.org, www.faithbb.org, www.faitbb.org, www.faithgb.org, www.faitgb.org, www.faith.org, www.faithbq.org, www.faithq.org, www.faithbw.org, www.faithw.org, www.faithbz.org, www.faithz.org, www.faithbx.org, www.faithx.org, www.faithb.org, www.faith.org, www.faithbs.org, www.faiths.org, www.faithby.org, www.faithy.org, www.faithbe.org, www.faithe.org, www.faithbd.org, www.faithd.org, www.faithbc.org, www.faithc.org,

    Other websites we recently analyzed

    1. LanternRadio.com
      Kirkland (United States) - 98.124.245.24
      Server software: Apache/2.2.15 (CentOS)
      Technology: Google Adsense, CSS, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 3
    2. nerdekampanya.com
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    3. Gingart - Magazine de Arte e Cultura
      Magazine de Arte e Cultura
      Portugal - 62.28.40.222
      G Analytics ID: UA-61447441-1
      Server software: Apache
      Technology: CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Google Analytics, Wordpress
      Number of Javascript: 14
      Number of meta tags: 5
    4. sylvie-jardin.fr
      Ma vie a basculé vers la lumière artistique,j'ai fait des stages et pris des cours de peinture avec cinq professeurs différent. Modelage au centre d'art à Alençon depuis cinq ans. Stage de sculpture et de maquillage sur Paris. Sept années de théatre clown. C'est une sorte de boulimie artistique. acceuillir l'émotion,la partager,la donner.
      Germany - 212.227.43.75
      Server software: Apache
      Technology: CSS, Google Font API, Html, Javascript, Google Analytics
      Number of Javascript: 1
      Number of meta tags: 10
    5. Dhanalakshmipaper « Paper World
      San Francisco (United States) - 104.28.16.118
      Server software: cloudflare-nginx
      Technology: CSS, Flexslider, Html, Javascript, jQuery Validate, Php, Pingback, Shortcodes, Wordpress
      Number of Javascript: 13
      Number of meta tags: 4
    6. GREENBRICK.COM
      Jacksonville (United States) - 205.178.189.131
      Server software: Sun-ONE-Web-Server/6.1
      Technology: Html
      Number of meta tags: 1
    7. imaphurricane.com
      Switzerland - 141.8.225.31
      Server software: Apache
      Technology: Html
    8. Welcome to poughkeepsiemedicalmalpracticelawyers.com
      Welcome to poughkeepsiemedicalmalpracticelawyers.com
      Dallas (United States) - 45.35.73.201
      Server software: nginx
      Technology: Google Adsense, Javascript, Php
      Number of Javascript: 5
      Number of meta tags: 4
    9. 如东县金鹰机械有限公司
      Dalian (China) - 42.202.150.115
      Server software:
      Technology: CSS, Html
      Number of meta tags: 1
    10. tcontinuity.com
      Australia - 202.124.241.178
      Server software: Redirector - NetRegistry Pty Ltd
      Technology: Html
      Number of meta tags: 2

    Check Other Websites